Class a: All alpha proteins [46456] (290 folds) |
Fold a.126: Serum albumin-like [48551] (1 superfamily) multihelical; one domain consists of two similar disulfide-linked subdomains |
Superfamily a.126.1: Serum albumin-like [48552] (2 families) |
Family a.126.1.1: Serum albumin-like [48553] (2 proteins) |
Protein Serum albumin [48554] (1 species) duplication: consists of three domains of this fold |
Species Human (Homo sapiens) [TaxId:9606] [48555] (96 PDB entries) Uniprot P02768 29-596 |
Domain d1uora1: 1uor A:4-196 [19396] |
PDB Entry: 1uor (more details), 2.8 Å
SCOPe Domain Sequences for d1uora1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uora1 a.126.1.1 (A:4-196) Serum albumin {Human (Homo sapiens) [TaxId: 9606]} ksevahrfkdlgeenfkalvliafaqylqqcpfedhvklvnevtefaktcvadesaencd kslhtlfgdklctvatlretygemadccakqepernecflqhkddnpnlprlvrpevdvm ctafhdneetflkkylyeiarrhpyfyapellffakrykaafteccqaadkaacllpkld elrdegkassakq
Timeline for d1uora1: