Lineage for d4hcxb_ (4hcx B:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1386088Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 1386089Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) (S)
    the constituent families form similar dimers
  5. 1386090Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 proteins)
    the active site is between the two identical subunits
  6. 1386193Protein automated matches [190072] (18 species)
    not a true protein
  7. 1386290Species Mycobacterium tuberculosis [TaxId:1773] [193947] (1 PDB entry)
  8. 1386292Domain d4hcxb_: 4hcx B: [193948]
    automated match to d1lwda_
    complexed with cl, mn, nap

Details for d4hcxb_

PDB Entry: 4hcx (more details), 2.18 Å

PDB Description: structure of icdh-1 from m.tuberculosis complexed with nadph & mn2+
PDB Compounds: (B:) Isocitrate dehydrogenase [NADP]

SCOPe Domain Sequences for d4hcxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hcxb_ c.77.1.1 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
pkikvsgpvveldgdemtrviwklikdmlilpyldirldyydlgiehrdatddqvtidaa
yaikkhgvgvkcatitpdearveefnlkkmwlspngtirnilggtifrepivisnvprlv
pgwtkpivigrhafgdqyratnfkvdqpgtvtltftpadgsapivhemvsipedggvvlg
mynfkesirdfarasfsyglnakwpvylstkntilkaydgmfkdefervyeeefkaqfea
agltyehrliddmvaaclkweggyvwacknydgdvqsdtvaqgygslglmtsvlmtadgk
tveaeaahgtvtrhyrqyqagkptstnpiasifawtrglqhrgkldgtpevidfahkles
vviatvesgkmtkdlailigpeqdwlnseefldaiadnleke

SCOPe Domain Coordinates for d4hcxb_:

Click to download the PDB-style file with coordinates for d4hcxb_.
(The format of our PDB-style files is described here.)

Timeline for d4hcxb_: