Lineage for d1bkea2 (1bke A:197-388)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1098092Fold a.126: Serum albumin-like [48551] (1 superfamily)
    multihelical; one domain consists of two similar disulfide-linked subdomains
  4. 1098093Superfamily a.126.1: Serum albumin-like [48552] (1 family) (S)
  5. 1098094Family a.126.1.1: Serum albumin-like [48553] (2 proteins)
  6. 1098095Protein Serum albumin [48554] (1 species)
    duplication: consists of three domains of this fold
  7. 1098096Species Human (Homo sapiens) [TaxId:9606] [48555] (50 PDB entries)
    Uniprot P02768 29-596
  8. 1098222Domain d1bkea2: 1bke A:197-388 [19388]
    complexed with b3i, myr

Details for d1bkea2

PDB Entry: 1bke (more details), 3.15 Å

PDB Description: human serum albumin in a complex with myristic acid and tri-iodobenzoic acid
PDB Compounds: (A:) serum albumin

SCOPe Domain Sequences for d1bkea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bkea2 a.126.1.1 (A:197-388) Serum albumin {Human (Homo sapiens) [TaxId: 9606]}
rlkcaslqkfgerafkawavarlsqrfpkaefaevsklvtdltkvhtecchgdllecadd
radlakyicenqdsissklkeccekpllekshciaevendempadlpslaadfveskdvc
knyaeakdvflgmflyeyarrhpdysvvlllrlaktyettlekccaaadphecyakvfde
fkplveepqnli

SCOPe Domain Coordinates for d1bkea2:

Click to download the PDB-style file with coordinates for d1bkea2.
(The format of our PDB-style files is described here.)

Timeline for d1bkea2: