Lineage for d3n2jl_ (3n2j L:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1114375Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 1114376Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 1114377Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
    mono-domain proteins
  6. 1114453Protein Azurin [49530] (6 species)
  7. 1114484Species Pseudomonas aeruginosa [TaxId:287] [49533] (74 PDB entries)
    Uniprot P00282
  8. 1114491Domain d3n2jl_: 3n2j L: [193710]
    automated match to d2iwea_
    complexed with cu

Details for d3n2jl_

PDB Entry: 3n2j (more details), 1.35 Å

PDB Description: azurin h117g, oxidized form
PDB Compounds: (L:) Azurin

SCOPe Domain Sequences for d3n2jl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3n2jl_ b.6.1.1 (L:) Azurin {Pseudomonas aeruginosa [TaxId: 287]}
aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpggsal
mkgtltlk

SCOPe Domain Coordinates for d3n2jl_:

Click to download the PDB-style file with coordinates for d3n2jl_.
(The format of our PDB-style files is described here.)

Timeline for d3n2jl_: