Lineage for d3o2la1 (3o2l A:1-303)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2830557Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 2831217Protein automated matches [190057] (28 species)
    not a true protein
  7. 2831376Species Thermoascus aurantiacus [TaxId:5087] [190006] (28 PDB entries)
  8. 2831409Domain d3o2la1: 3o2l A:1-303 [193689]
    Other proteins in same PDB: d3o2la2, d3o2la3
    automated match to d1goka_

Details for d3o2la1

PDB Entry: 3o2l (more details), 2 Å

PDB Description: Crystal Structure of an Inactive Kemp Elimination Design HG-1
PDB Compounds: (A:) endo-1,4-beta-xylanase

SCOPe Domain Sequences for d3o2la1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3o2la1 c.1.8.3 (A:1-303) automated matches {Thermoascus aurantiacus [TaxId: 5087]}
eaaqsvdqlikargkvyfgvmtdqnrlttgknaaiiqadfgqvtpmnsmkwdatepsqgn
fnfagadylvnwaqqngklirghtlvghfylpswvssitdkntltnvmknhittlmtryk
gkirawdvvneafnedgslrqtvflnvigedyipiafqtaraadpnaklyindynldsas
ypktqaivnrvkqwraagvpidgigsqthlsagqgagvlqalpllasagtpevaitelnv
agasptdyvnvvnaclnvqscvgitvagvadpdswrasttpllfdgnfnpkpaynaivqd
lqq

SCOPe Domain Coordinates for d3o2la1:

Click to download the PDB-style file with coordinates for d3o2la1.
(The format of our PDB-style files is described here.)

Timeline for d3o2la1: