![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) ![]() |
![]() | Family c.1.8.3: beta-glycanases [51487] (27 proteins) consist of a number of sequence families |
![]() | Protein automated matches [190057] (28 species) not a true protein |
![]() | Species Thermoascus aurantiacus [TaxId:5087] [190006] (28 PDB entries) |
![]() | Domain d3o2la1: 3o2l A:1-303 [193689] Other proteins in same PDB: d3o2la2, d3o2la3 automated match to d1goka_ |
PDB Entry: 3o2l (more details), 2 Å
SCOPe Domain Sequences for d3o2la1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3o2la1 c.1.8.3 (A:1-303) automated matches {Thermoascus aurantiacus [TaxId: 5087]} eaaqsvdqlikargkvyfgvmtdqnrlttgknaaiiqadfgqvtpmnsmkwdatepsqgn fnfagadylvnwaqqngklirghtlvghfylpswvssitdkntltnvmknhittlmtryk gkirawdvvneafnedgslrqtvflnvigedyipiafqtaraadpnaklyindynldsas ypktqaivnrvkqwraagvpidgigsqthlsagqgagvlqalpllasagtpevaitelnv agasptdyvnvvnaclnvqscvgitvagvadpdswrasttpllfdgnfnpkpaynaivqd lqq
Timeline for d3o2la1: