PDB entry 3o2l

View 3o2l on RCSB PDB site
Description: Crystal Structure of an Inactive Kemp Elimination Design HG-1
Class: hydrolase
Keywords: tim barrel, Kemp eliminase, Kemp elimination, HYDROLASE
Deposited on 2010-07-22, released 2011-07-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-04-25, with a file datestamp of 2012-04-20.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.17
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endo-1,4-beta-xylanase
    Species: THERMOASCUS AURANTIACUS [TaxId:5087]
    Gene: xynA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23360 (1-303)
      • expression tag (0)
      • engineered mutation (1)
      • engineered mutation (21)
      • engineered mutation (46)
      • engineered mutation (87)
      • engineered mutation (89-90)
      • engineered mutation (239)
      • engineered mutation (267)
      • expression tag (304-305)
    Domains in SCOPe 2.07: d3o2la1, d3o2la2, d3o2la3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3o2lA (A:)
    aeaaqsvdqlikargkvyfgvmtdqnrlttgknaaiiqadfgqvtpmnsmkwdatepsqg
    nfnfagadylvnwaqqngklirghtlvghfylpswvssitdkntltnvmknhittlmtry
    kgkirawdvvneafnedgslrqtvflnvigedyipiafqtaraadpnaklyindynldsa
    sypktqaivnrvkqwraagvpidgigsqthlsagqgagvlqalpllasagtpevaiteln
    vagasptdyvnvvnaclnvqscvgitvagvadpdswrasttpllfdgnfnpkpaynaivq
    dlqqgsiegrghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3o2lA (A:)
    aeaaqsvdqlikargkvyfgvmtdqnrlttgknaaiiqadfgqvtpmnsmkwdatepsqg
    nfnfagadylvnwaqqngklirghtlvghfylpswvssitdkntltnvmknhittlmtry
    kgkirawdvvneafnedgslrqtvflnvigedyipiafqtaraadpnaklyindynldsa
    sypktqaivnrvkqwraagvpidgigsqthlsagqgagvlqalpllasagtpevaiteln
    vagasptdyvnvvnaclnvqscvgitvagvadpdswrasttpllfdgnfnpkpaynaivq
    dlqqgs