Lineage for d3p89a_ (3p89 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2008559Protein Bile acid receptor FXR [101433] (2 species)
  7. 2008560Species Human (Homo sapiens) [TaxId:9606] [101434] (8 PDB entries)
  8. 2008564Domain d3p89a_: 3p89 A: [193652]
    automated match to d3ruua_
    complexed with 89p, so4

Details for d3p89a_

PDB Entry: 3p89 (more details), 2.3 Å

PDB Description: fxr bound to a quinolinecarboxylic acid
PDB Compounds: (A:) Farnesoid X receptor

SCOPe Domain Sequences for d3p89a_:

Sequence, based on SEQRES records: (download)

>d3p89a_ a.123.1.1 (A:) Bile acid receptor FXR {Human (Homo sapiens) [TaxId: 9606]}
pdqqtllhfimdsynkqrmpqeitnkilkeefsaeenfliltematnhvqvlveftkklp
gfqtldhedqiallkgsaveamflrsaeifnkklpsghsdlleerirnsgisdeyitpmf
sfyksigelkmtqeeyalltaivilspdrqyikdreaveklqeplldvlqklckihqpen
pqhfaellgrltelrtfnhhhaemlmswrvndhkftplleeiwdv

Sequence, based on observed residues (ATOM records): (download)

>d3p89a_ a.123.1.1 (A:) Bile acid receptor FXR {Human (Homo sapiens) [TaxId: 9606]}
pdqqtllhfimdsynkqrmpqeitnkilkeefsaeenfliltematnhvqvlveftkklp
gfqtldhedqiallkgsaveamflrsaeifnkklpsghsdlleerirnsgisdeyitpmf
sfyksigelkmtqeeyalltaivilspdrqydreaveklqeplldvlqklckihqpenpq
hfaellgrltelrtfnhhhaemlmswrvndhkftplleeiwdv

SCOPe Domain Coordinates for d3p89a_:

Click to download the PDB-style file with coordinates for d3p89a_.
(The format of our PDB-style files is described here.)

Timeline for d3p89a_: