Lineage for d3fdxb_ (3fdx B:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1590099Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 1590910Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. 1591169Family c.26.2.0: automated matches [191320] (1 protein)
    not a true family
  6. 1591170Protein automated matches [190116] (16 species)
    not a true protein
  7. 1591204Species Klebsiella pneumoniae [TaxId:272620] [193623] (2 PDB entries)
  8. 1591206Domain d3fdxb_: 3fdx B: [193624]
    automated match to d2pfsa_
    complexed with atp, fmt, mg

Details for d3fdxb_

PDB Entry: 3fdx (more details), 1.58 Å

PDB Description: putative filament protein / universal stress protein f from klebsiella pneumoniae.
PDB Compounds: (B:) Putative filament protein / universal stress protein F

SCOPe Domain Sequences for d3fdxb_:

Sequence, based on SEQRES records: (download)

>d3fdxb_ c.26.2.0 (B:) automated matches {Klebsiella pneumoniae [TaxId: 272620]}
snailvpidisdkefteriishveseariddaevhfltvipslpyyaslgmaytaelpgm
delregsetqlkeiakkfsipedrmhfhvaegspkdkilalakslpadlviiashrpdit
tyllgsnaaavvrhaecsvlvvr

Sequence, based on observed residues (ATOM records): (download)

>d3fdxb_ c.26.2.0 (B:) automated matches {Klebsiella pneumoniae [TaxId: 272620]}
snailvpidisdkefteriishveseariddaevhfltvipsgmdelregsetqlkeiak
kfsipedrmhfhvaegspkdkilalakslpadlviiashrpdittyllgsnaaavvrhae
csvlvvr

SCOPe Domain Coordinates for d3fdxb_:

Click to download the PDB-style file with coordinates for d3fdxb_.
(The format of our PDB-style files is described here.)

Timeline for d3fdxb_: