Lineage for d3s4xa_ (3s4x A:)

  1. Root: SCOPe 2.04
  2. 1689992Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1690252Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1690253Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1690254Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 1690268Protein AMPC beta-Lactamase, class C [56618] (3 species)
    contains small alpha+beta subdomain inserted in the common fold
  7. 1690275Species Enterobacter cloacae, P99, cephalosporinase [TaxId:550] [56620] (9 PDB entries)
    Uniprot P05364 22-380 ! Uniprot P05364 22-381
  8. 1690281Domain d3s4xa_: 3s4x A: [193609]
    automated match to d1gcea_
    complexed with so4; mutant

Details for d3s4xa_

PDB Entry: 3s4x (more details), 1.95 Å

PDB Description: Crystal structure of the Asn152Gly mutant of P99 beta-lactamase
PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d3s4xa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3s4xa_ e.3.1.1 (A:) AMPC beta-Lactamase, class C {Enterobacter cloacae, P99, cephalosporinase [TaxId: 550]}
tpvsekqlaevvantvtplmkaqsvpgmavaviyqgkphyytfgkadiaankpvtpqtlf
elgsisktftgvlggdaiargeislddpvtrywpqltgkqwqgirmldlatytagglplq
vpdevtdnasllrfyqnwqpqwkpgttrlyagasiglfgalavkpsgmpyeqamttrvlk
plkldhtwinvpkaeeahyawgyrdgkavrvspgmldaqaygvktnvqdmanwvmanmap
envadaslkqgialaqsrywrigsmyqglgwemlnwpveantvvegsdskvalaplpvve
vnppappvkaswvhktgstggfgsyvafipekqigivmlantsypnparveaayhileal
qhhhhhh

SCOPe Domain Coordinates for d3s4xa_:

Click to download the PDB-style file with coordinates for d3s4xa_.
(The format of our PDB-style files is described here.)

Timeline for d3s4xa_: