Lineage for d3ur2a_ (3ur2 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1820872Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 1820984Family c.1.9.3: Phosphotriesterase-like [51564] (3 proteins)
    automatically mapped to Pfam PF02126
  6. 1820985Protein Phosphotriesterase (parathion hydrolase, PTE) [51565] (4 species)
  7. 1821002Species Brevundimonas diminuta [TaxId:293] [193602] (5 PDB entries)
  8. 1821009Domain d3ur2a_: 3ur2 A: [193603]
    automated match to d1p6cb_
    complexed with co, edo, imd; mutant

Details for d3ur2a_

PDB Entry: 3ur2 (more details), 2 Å

PDB Description: crystal structure of pte mutant h254g/h257w/l303t/k185r/i274n/a80v
PDB Compounds: (A:) Parathion hydrolase

SCOPe Domain Sequences for d3ur2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ur2a_ c.1.9.3 (A:) Phosphotriesterase (parathion hydrolase, PTE) {Brevundimonas diminuta [TaxId: 293]}
drintvrgpitiseagftlthehicgssagflrawpeffgsrkalvekavrglrraraag
vrtivdvstfdigrdvsllaevsraadvhivaatglwfdpplsmrlrsveeltqfflrei
qygiedtgiragiikvattgkatpfqelvlraaaraslatgvpvtthtaasqrdgeqqaa
ifeseglspsrvcighsddtddlsyltalaargyligldgipwsaiglednasasallgn
rswqtrallikalidqgymkqilvsndwtfgfssyvtnimdvmdrvnpdgmafiplrvip
flrekgvpqetlagitvtnparflspt

SCOPe Domain Coordinates for d3ur2a_:

Click to download the PDB-style file with coordinates for d3ur2a_.
(The format of our PDB-style files is described here.)

Timeline for d3ur2a_: