Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
Superfamily c.56.4: Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53182] (2 families) |
Family c.56.4.0: automated matches [191433] (1 protein) not a true family |
Protein automated matches [190623] (6 species) not a true protein |
Species Xenorhabdus bovienii [TaxId:406818] [193515] (2 PDB entries) |
Domain d4gxhb_: 4gxh B: [193516] automated match to d3ro0b_ complexed with cl, po4 |
PDB Entry: 4gxh (more details), 2.7 Å
SCOPe Domain Sequences for d4gxhb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4gxhb_ c.56.4.0 (B:) automated matches {Xenorhabdus bovienii [TaxId: 406818]} mktilvtafdpfggeainpsweaikplqgsqvfganieicqipcifdtslehlyaavdky qpelvisvgqaggrtnitvervainindaripdnagnqpidtpvivdgpaayfsrlpikt mvnalntagipasvsqtagtfvcnhvmygllhylaqntpsvrggfihvpylpeqavkdgn qssmtlmlmtlalkiaietawknts
Timeline for d4gxhb_: