![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
![]() | Superfamily c.56.4: Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53182] (2 families) ![]() |
![]() | Family c.56.4.0: automated matches [191433] (1 protein) not a true family |
![]() | Protein automated matches [190623] (6 species) not a true protein |
![]() | Species Xenorhabdus bovienii [TaxId:406818] [193515] (2 PDB entries) |
![]() | Domain d4gxhc_: 4gxh C: [202308] automated match to d4gxhb_ complexed with cl, po4 |
PDB Entry: 4gxh (more details), 2.7 Å
SCOPe Domain Sequences for d4gxhc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4gxhc_ c.56.4.0 (C:) automated matches {Xenorhabdus bovienii [TaxId: 406818]} ktilvtafdpfggeainpsweaikplqgsqvfganieicqipcifdtslehlyaavdkyq pelvisvgqaggrtnitvervainindaripdnagnqpidtpvivdgpaayfsrlpiktm vnalntagipasvsqtagtfvcnhvmygllhylaqntpsvrggfihvpylpeqavkdgnq ssmtlmlmtlalkiaietawkn
Timeline for d4gxhc_: