Lineage for d1bm0b1 (1bm0 B:5-196)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1098092Fold a.126: Serum albumin-like [48551] (1 superfamily)
    multihelical; one domain consists of two similar disulfide-linked subdomains
  4. 1098093Superfamily a.126.1: Serum albumin-like [48552] (1 family) (S)
  5. 1098094Family a.126.1.1: Serum albumin-like [48553] (2 proteins)
  6. 1098095Protein Serum albumin [48554] (1 species)
    duplication: consists of three domains of this fold
  7. 1098096Species Human (Homo sapiens) [TaxId:9606] [48555] (50 PDB entries)
    Uniprot P02768 29-596
  8. 1098140Domain d1bm0b1: 1bm0 B:5-196 [19351]

Details for d1bm0b1

PDB Entry: 1bm0 (more details), 2.5 Å

PDB Description: crystal structure of human serum albumin
PDB Compounds: (B:) serum albumin

SCOPe Domain Sequences for d1bm0b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bm0b1 a.126.1.1 (B:5-196) Serum albumin {Human (Homo sapiens) [TaxId: 9606]}
sevahrfkdlgeenfkalvliafaqylqqcpfedhvklvnevtefaktcvadesaencdk
slhtlfgdklctvatlretygemadccakqepernecflqhkddnpnlprlvrpevdvmc
tafhdneetflkkylyeiarrhpyfyapellffakrykaafteccqaadkaacllpklde
lrdegkassakq

SCOPe Domain Coordinates for d1bm0b1:

Click to download the PDB-style file with coordinates for d1bm0b1.
(The format of our PDB-style files is described here.)

Timeline for d1bm0b1: