Lineage for d4as5a_ (4as5 A:)

  1. Root: SCOPe 2.02
  2. 1232558Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1233851Fold e.7: Carbohydrate phosphatase [56654] (1 superfamily)
    N-terminal domain is an alpha+beta, C-terminal domain is an alpha/beta with mixed beta-sheet
  4. 1233852Superfamily e.7.1: Carbohydrate phosphatase [56655] (3 families) (S)
  5. 1233853Family e.7.1.1: Inositol monophosphatase/fructose-1,6-bisphosphatase-like [56656] (7 proteins)
  6. 1234035Protein automated matches [190281] (4 species)
    not a true protein
  7. 1234101Species Mus musculus [TaxId:10090] [193469] (1 PDB entry)
  8. 1234102Domain d4as5a_: 4as5 A: [193471]
    automated match to d2hhma_
    complexed with edo, gol, iod, mg, po4

Details for d4as5a_

PDB Entry: 4as5 (more details), 2.43 Å

PDB Description: Structure of mouse inositol monophosphatase 1
PDB Compounds: (A:) inositol monophosphatase 1

SCOPe Domain Sequences for d4as5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4as5a_ e.7.1.1 (A:) automated matches {Mus musculus [TaxId: 10090]}
dpwqecmdyavilarqagemirealknemdvmiksspadlvtvtdqkvekmlmssikeky
pchsfigeesvaagektvfteqptwvidpidgttnfvhrfpfvavsigflvnkemefgiv
yscvedkmytgrkgkgafcngqklqvsqqeditksllvtelgssrkpetlrivlsnmekl
csipihgirsvgtaavnmclvatggadayyemgihcwdmagagiivteaggvlmdvtggp
fdlmsrriiaansitlakriakeieiiplqrdde

SCOPe Domain Coordinates for d4as5a_:

Click to download the PDB-style file with coordinates for d4as5a_.
(The format of our PDB-style files is described here.)

Timeline for d4as5a_: