Lineage for d4as5b_ (4as5 B:)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2246418Fold e.7: Carbohydrate phosphatase [56654] (1 superfamily)
    N-terminal domain is an alpha+beta, C-terminal domain is an alpha/beta with mixed beta-sheet
  4. 2246419Superfamily e.7.1: Carbohydrate phosphatase [56655] (3 families) (S)
  5. 2246420Family e.7.1.1: Inositol monophosphatase/fructose-1,6-bisphosphatase-like [56656] (7 proteins)
  6. 2246632Protein automated matches [190281] (5 species)
    not a true protein
  7. 2246727Species Mouse (Mus musculus) [TaxId:10090] [193469] (1 PDB entry)
  8. 2246729Domain d4as5b_: 4as5 B: [193470]
    automated match to d2hhma_
    complexed with edo, gol, iod, mg, po4

Details for d4as5b_

PDB Entry: 4as5 (more details), 2.43 Å

PDB Description: Structure of mouse inositol monophosphatase 1
PDB Compounds: (B:) inositol monophosphatase 1

SCOPe Domain Sequences for d4as5b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4as5b_ e.7.1.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dpwqecmdyavilarqagemirealknemdvmiksspadlvtvtdqkvekmlmssikeky
pchsfigeesvaagektvfteqptwvidpidgttnfvhrfpfvavsigflvnkemefgiv
yscvedkmytgrkgkgafcngqklqvsqqeditksllvtelgssrkpetlrivlsnmekl
csipihgirsvgtaavnmclvatggadayyemgihcwdmagagiivteaggvlmdvtggp
fdlmsrriiaansitlakriakeieiiplqrdde

SCOPe Domain Coordinates for d4as5b_:

Click to download the PDB-style file with coordinates for d4as5b_.
(The format of our PDB-style files is described here.)

Timeline for d4as5b_: