Lineage for d4gted_ (4gte D:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1228972Fold d.207: Thymidylate synthase-complementing protein Thy1 [69795] (1 superfamily)
    complex alpha+beta fold; contains antiparallel 5-stranded beta-sheet: order 12354
  4. 1228973Superfamily d.207.1: Thymidylate synthase-complementing protein Thy1 [69796] (1 family) (S)
  5. 1228974Family d.207.1.1: Thymidylate synthase-complementing protein Thy1 [69797] (2 proteins)
  6. 1229013Protein automated matches [191028] (2 species)
    not a true protein
  7. 1229027Species Thermotoga maritima [TaxId:243274] [188837] (6 PDB entries)
  8. 1229031Domain d4gted_: 4gte D: [193458]
    automated match to d1o2ab_
    complexed with fad, mef; mutant

Details for d4gted_

PDB Entry: 4gte (more details), 1.89 Å

PDB Description: T. Maritima FDTS (E144R mutant) with FAD and Folate
PDB Compounds: (D:) Thymidylate synthase thyX

SCOPe Domain Sequences for d4gted_:

Sequence, based on SEQRES records: (download)

>d4gted_ d.207.1.1 (D:) automated matches {Thermotoga maritima [TaxId: 243274]}
mkidildkgfvelvdvmgndlsavraarvsfdmglkdeerdrhlieylmkhghetpfehi
vftfhvkapifvarqwfrhriasynelsgrysklsyefyipsperlegykttippervte
kiseivdkayrtyleliesgvprrvarivlplnlytrffwtvnarslmnflnlradshaq
weiqqyalaiarifkekcpwtfeaflkyaykgdilkev

Sequence, based on observed residues (ATOM records): (download)

>d4gted_ d.207.1.1 (D:) automated matches {Thermotoga maritima [TaxId: 243274]}
mkidildkgfvelvdvmgndlsavraarvsfddeerdrhlieylmkhghetpfehivftf
hvkapifvarqwfrhriasynelsgrysklsyefyipsperlegykttippervtekise
ivdkayrtyleliesgvprrvarivlplnlytrffwtvnarslmnflnlradshaqweiq
qyalaiarifkekcpwtfeaflkyaykgdilkev

SCOPe Domain Coordinates for d4gted_:

Click to download the PDB-style file with coordinates for d4gted_.
(The format of our PDB-style files is described here.)

Timeline for d4gted_: