Lineage for d4ajca_ (4ajc A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1386088Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 1386089Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) (S)
    the constituent families form similar dimers
  5. 1386090Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 proteins)
    the active site is between the two identical subunits
  6. 1386193Protein automated matches [190072] (18 species)
    not a true protein
  7. 1386256Species Escherichia coli [TaxId:562] [193425] (5 PDB entries)
  8. 1386260Domain d4ajca_: 4ajc A: [193426]
    automated match to d1pb1a_
    complexed with a2p, akg, ca, so4; mutant

Details for d4ajca_

PDB Entry: 4ajc (more details), 2.3 Å

PDB Description: 3d structure of e. coli isocitrate dehydrogenase k100m mutant in complex with alpha-ketoglutarate, calcium(ii) and adenine nucleotide phosphate
PDB Compounds: (A:) NADP Isocitrate dehydrogenase

SCOPe Domain Sequences for d4ajca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ajca_ c.77.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
eskvvvpaqgkkitlqngklnvpenpiipyiegdgigvdvtpamlkvvdaavekaykger
kiswmeiytgekstqvygqdvwlpaetldlireyrvaimgplttpvgggirslnvalrqe
ldlyiclrpvryyqgtpspvkhpeltdmvifrensediyagiewkadsadaekvikflre
emgvkkirfpehcgigikpcseegtkrlvraaieyaiandrdsvtlvhkgnimkftegaf
kdwgyqlareefggelidggpwlkvknpntgkeivikdviadaflqqillrpaeydviac
mnlngdyisdalaaqvggigiapganigdecalfeathgtapkyagqdkvnpgsiilsae
mmlrhmgwteaadlivkgmegainaktvtydferlmdgakllkcsefgdaiienm

SCOPe Domain Coordinates for d4ajca_:

Click to download the PDB-style file with coordinates for d4ajca_.
(The format of our PDB-style files is described here.)

Timeline for d4ajca_: