SCOPe 2.05: Domain d4gs7a_: 4gs7 A:

Lineage for d4gs7a_ (4gs7 A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (4 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.2: Short-chain cytokines [47286] (14 proteins)

6. Protein Interleukin-15 (IL-15) [158422] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [158423] (3 PDB entries)
   Uniprot P40933 49-162

8. Domain d4gs7a_: 4gs7 A: [193400]
   Other proteins in same PDB: d4gs7b1, d4gs7b2, d4gs7c1, d4gs7c2, d4gs7d_
   automated match to d2z3rc_
   complexed with act, edo, nag

Details for d4gs7a_

PDB Entry: 4gs7, 2.35 Å

PDB Description: structure of the interleukin-15 quaternary complex

PDB Compounds: (A:) Interleukin-15

SCOPe Domain Sequences for d4gs7a_:

Sequence; same for both SEQRES and ATOM records:

>d4gs7a_ a.26.1.2 (A:) Interleukin-15 (IL-15) {Human (Homo sapiens) [TaxId: 9606]}
mgnwvnvisdlkkiedliqsmhidatlytesdvhpsckvtamkcfllelqvislesgdas
ihdtvenliilannslssngnvtesgckeceeleeknikeflqsfvhivqmfin

Timeline for d4gs7a_:

• d4gs7a_ first appeared in SCOPe 2.02
  
• d4gs7a_ appears in SCOPe 2.04
  
• d4gs7a_ is called d4gs7a1 in SCOPe 2.06
  
• d4gs7a_ appears in the current release, SCOPe 2.08, called d4gs7a1