SCOPe 2.04: Domain d4hn1a_: 4hn1 A:

Lineage for d4hn1a_ (4hn1 A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.0: automated matches [191354] (1 protein)
   not a true family

6. Protein automated matches [190388] (18 species)
   not a true protein

7. Species Streptomyces bikiniensis [TaxId:1896] [193359] (3 PDB entries)

8. Domain d4hn1a_: 4hn1 A: [193360]
   automated match to d2c0za1
   complexed with edo, tdr, thm, tyd; mutant

Details for d4hn1a_

PDB Entry: 4hn1, 1.6 Å

PDB Description: Crystal Structure of H60N/Y130F double mutant of ChmJ, a 3'-monoepimerase from Streptomyces bikiniensis in complex with dTDP

PDB Compounds: (A:) Putative 3-epimerase in D-allose pathway

SCOPe Domain Sequences for d4hn1a_:

Sequence; same for both SEQRES and ATOM records:

>d4hn1a_ b.82.1.0 (A:) automated matches {Streptomyces bikiniensis [TaxId: 1896]}
mhplsiegawsqepvihsdhrgrshewfrgesfrqafghdfpvaqvnvavshrgalrgin
yteippgqakysvcvrgagldvvvdvrigsptfgrweivpmdaerntavyltaglgrafl
sltddatlvflcssgyaparehsvnpldpdlgiawpddiepllsdrdenaptlataerlg
llptyqawqeqqqaqrleh

Timeline for d4hn1a_:

• d4hn1a_ first appeared in SCOPe 2.02
  
• d4hn1a_ appears in SCOPe 2.03
  
• d4hn1a_ appears in SCOPe 2.05
  
• d4hn1a_ appears in the current release, SCOPe 2.08, called d4hn1a1