Lineage for d3w3ea_ (3w3e A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2171118Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 2171119Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 2171120Family d.2.1.1: Family 19 glycosidase [53956] (2 proteins)
    automatically mapped to Pfam PF00182
  6. 2171128Protein automated matches [190455] (7 species)
    not a true protein
  7. 2171137Species Cowpea (Vigna unguiculata) [TaxId:3917] [193285] (1 PDB entry)
  8. 2171138Domain d3w3ea_: 3w3e A: [193286]
    automated match to d1dxja_

Details for d3w3ea_

PDB Entry: 3w3e (more details), 1.5 Å

PDB Description: Structure of Vigna unguiculata chitinase with regulation activity of the plant cell wall
PDB Compounds: (A:) Cotyledoneous yieldin-like protein

SCOPe Domain Sequences for d3w3ea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3w3ea_ d.2.1.1 (A:) automated matches {Cowpea (Vigna unguiculata) [TaxId: 3917]}
aevgsvigaslfdqllkhrndqacegkgfysynafitaarsfaafgttgdsntrkrevaa
flaqtshettggaatspdgpyawgycfvterdksnrycdgsgpcsagksyygrgpiqlth
nynynaagralgvdlinnpdlvardavvsfktalwfwmtpqgnkpschdvitnrwtpsaa
dkaanrvpgfgvitniingglecgkgptpasgdrigfykrycdvfgvsygpnlncrdqrp
fg

SCOPe Domain Coordinates for d3w3ea_:

Click to download the PDB-style file with coordinates for d3w3ea_.
(The format of our PDB-style files is described here.)

Timeline for d3w3ea_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3w3eb_