SCOPe 2.08: Domain d4hkyb1: 4hky B:31-270

Lineage for d4hkyb1 (4hky B:31-270)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families)

5. Family d.157.1.0: automated matches [191360] (1 protein)
   not a true family

6. Protein automated matches [190418] (31 species)
   not a true protein

7. Species Klebsiella pneumoniae [TaxId:573] [189718] (103 PDB entries)

8. Domain d4hkyb1: 4hky B:31-270 [193278]
   Other proteins in same PDB: d4hkyb2
   automated match to d3srxa_
   complexed with cd, cl, fpm, gol, sfr

Details for d4hkyb1

PDB Entry: 4hky, 2 Å

PDB Description: new delhi metallo-beta-lactamase-1, complexed with cd and faropenem

PDB Compounds: (B:) Beta-lactamase NDM-1

SCOPe Domain Sequences for d4hkyb1:

Sequence; same for both SEQRES and ATOM records:

>d4hkyb1 d.157.1.0 (B:31-270) automated matches {Klebsiella pneumoniae [TaxId: 573]}
irptigqqmetgdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlvvd
tawtddqtaqilnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlap
qegmvaaqhsltfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggcli
kdskakslgnlgdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadklr

Timeline for d4hkyb1:

• d4hkyb1 first appeared in SCOPe 2.02, called d4hkyb_
  
• d4hkyb1 appears in SCOPe 2.07