SCOPe 2.06: Domain d4eomc1: 4eom C:1-296

Lineage for d4eomc1 (4eom C:1-296)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Cyclin-dependent PK, CDK2 [88855] (2 species)
   CMGC group; CDKs subfamily; serine/threonine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [88856] (374 PDB entries)
   Uniprot P24941

8. Domain d4eomc1: 4eom C:1-296 [193262]
   Other proteins in same PDB: d4eoma2, d4eomb1, d4eomb2, d4eomc2, d4eomd1, d4eomd2
   automated match to d3bhta_
   complexed with atp, mg

Details for d4eomc1

PDB Entry: 4eom, 2.1 Å

PDB Description: thr 160 phosphorylated cdk2 h84s, q85m, q131e - human cyclin a3 complex with atp

PDB Compounds: (C:) cyclin-dependent kinase 2

SCOPe Domain Sequences for d4eomc1:

Sequence, based on SEQRES records:

>d4eomc1 d.144.1.7 (C:1-296) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]}
menfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllkelnh
pnivklldvihtenklylvfeflsmdlkkfmdasaltgiplpliksylfqllqglafchs
hrvlhrdlkpenllintegaikladfglarafgvpvrtythevvtlwyrapeillgckyy
stavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykpsf
pkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphl

Sequence, based on observed residues (ATOM records):

>d4eomc1 d.144.1.7 (C:1-296) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]}
menfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllkelnh
pnivklldvihtenklylvfeflsmdlkkfmdasaltgiplpliksylfqllqglafchs
hrvlhrdlkpenllintegaikladfglarafgvpvrtythevvtlwyrapeillgckyy
stavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtqdfskvvppldedgrslls
qmlhydpnkrisakaalahpffqdvtkpvphl

Timeline for d4eomc1:

• d4eomc1 first appeared in SCOPe 2.02, called d4eomc_
  
• d4eomc1 was called d4eomc_ in SCOPe 2.05
  
• d4eomc1 appears in SCOPe 2.07
  
• d4eomc1 appears in the current release, SCOPe 2.08