| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily) consists of two intertwined (sub)domains related by pseudo dyad; duplication 3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest |
Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) ![]() the constituent families form similar dimers |
| Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 proteins) the active site is between the two identical subunits |
| Protein automated matches [190072] (18 species) not a true protein |
| Species Burkholderia thailandensis [TaxId:271848] [193254] (1 PDB entry) |
| Domain d4iwhb_: 4iwh B: [193255] automated match to d1a05a_ complexed with mg |
PDB Entry: 4iwh (more details), 1.75 Å
SCOPe Domain Sequences for d4iwhb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4iwhb_ c.77.1.1 (B:) automated matches {Burkholderia thailandensis [TaxId: 271848]}
mkiavlpgdgigpeivneavkvlnaldekfelehapvggagyeasghplpdatlalakea
dailfgavgdwkydsleralrpeqailglrkhlelfanfrpaicypqlvdasplkpelva
gldilivrelngdiyfgqprgvraapdgpfageregfdtmrysepevrriahvafqaaqk
rakkllsvdksnvletsqfwrdvmidvskeyadvelshmyvdnaamqlakapkqfdvivt
gnmfgdilsdeasmltgsigmlpsasldknnkglyepshgsapdiagkgianplatilsa
amllryslnraeqadrieravktvleqgyrtgdiatpgcrqvgtaamgdavvaal
Timeline for d4iwhb_: