Lineage for d4iwhb_ (4iwh B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1873551Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 1873552Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) (S)
    the constituent families form similar dimers
  5. 1873553Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 proteins)
    the active site is between the two identical subunits
  6. 1873662Protein automated matches [190072] (18 species)
    not a true protein
  7. 1873707Species Burkholderia thailandensis [TaxId:271848] [193254] (1 PDB entry)
  8. 1873709Domain d4iwhb_: 4iwh B: [193255]
    automated match to d1a05a_
    complexed with mg

Details for d4iwhb_

PDB Entry: 4iwh (more details), 1.75 Å

PDB Description: Crystal structure of a 3-isopropylmalate dehydrogenase from Burkholderia pseudomallei
PDB Compounds: (B:) 3-isopropylmalate dehydrogenase

SCOPe Domain Sequences for d4iwhb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4iwhb_ c.77.1.1 (B:) automated matches {Burkholderia thailandensis [TaxId: 271848]}
mkiavlpgdgigpeivneavkvlnaldekfelehapvggagyeasghplpdatlalakea
dailfgavgdwkydsleralrpeqailglrkhlelfanfrpaicypqlvdasplkpelva
gldilivrelngdiyfgqprgvraapdgpfageregfdtmrysepevrriahvafqaaqk
rakkllsvdksnvletsqfwrdvmidvskeyadvelshmyvdnaamqlakapkqfdvivt
gnmfgdilsdeasmltgsigmlpsasldknnkglyepshgsapdiagkgianplatilsa
amllryslnraeqadrieravktvleqgyrtgdiatpgcrqvgtaamgdavvaal

SCOPe Domain Coordinates for d4iwhb_:

Click to download the PDB-style file with coordinates for d4iwhb_.
(The format of our PDB-style files is described here.)

Timeline for d4iwhb_: