Lineage for d4iroc_ (4iro C:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1976410Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1976411Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1976495Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1976766Protein Hemoglobin, alpha-chain [46486] (24 species)
  7. 1976841Species Emerald rockcod (Pagothenia bernacchii) [TaxId:40690] [46495] (12 PDB entries)
  8. 1976860Domain d4iroc_: 4iro C: [193244]
    Other proteins in same PDB: d4irob_, d4irod_
    automated match to d2h8fa_
    complexed with cmo, hem

Details for d4iroc_

PDB Entry: 4iro (more details), 2.2 Å

PDB Description: Crystal structure of T-state carbonmonoxy hemoglobin from Trematomus bernacchii at pH 8.4
PDB Compounds: (C:) Hemoglobin subunit alpha

SCOPe Domain Sequences for d4iroc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4iroc_ a.1.1.2 (C:) Hemoglobin, alpha-chain {Emerald rockcod (Pagothenia bernacchii) [TaxId: 40690]}
slsdkdkaavralwskigksadaigndalsrmivvypqtktyfshwpdvtpgsphikahg
kkvmggialavskiddlktglmelseqhayklrvdpanfkilnhcilvvistmfpkeftp
eahvsldkflsgvalalaeryr

SCOPe Domain Coordinates for d4iroc_:

Click to download the PDB-style file with coordinates for d4iroc_.
(The format of our PDB-style files is described here.)

Timeline for d4iroc_: