Lineage for d3zota_ (3zot A:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2633923Fold f.51: Rhomboid-like [144090] (1 superfamily)
    6 transmembrane helices
  4. 2633924Superfamily f.51.1: Rhomboid-like [144091] (2 families) (S)
  5. 2633925Family f.51.1.1: Rhomboid-like [144092] (3 proteins)
    Pfam PF01694; transmembrane serine protease
  6. 2633926Protein GlpG [144095] (1 species)
  7. 2633927Species Escherichia coli [TaxId:562] [144096] (19 PDB entries)
    Uniprot P09391 91-272
  8. 2633937Domain d3zota_: 3zot A: [193164]
    automated match to d2ic8a1
    complexed with bng, cl, l6c

Details for d3zota_

PDB Entry: 3zot (more details), 2.4 Å

PDB Description: structure of e.coli rhomboid protease glpg in complex with monobactam l29 (data set 2)
PDB Compounds: (A:) rhomboid protease glpg

SCOPe Domain Sequences for d3zota_:

Sequence, based on SEQRES records: (download)

>d3zota_ f.51.1.1 (A:) GlpG {Escherichia coli [TaxId: 562]}
ragpvtwvmmiacvvvfiamqilgdqevmlwlawpfdptlkfefwryfthalmhfslmhi
lfnllwwwylggavekrlgsgklivitlisallsgyvqqkfsgpwfgglsgvvyalmgyv
wlrgerdpqsgiylqrgliifaliwivagwfdlfgmsmangahiaglavglamafvdsln

Sequence, based on observed residues (ATOM records): (download)

>d3zota_ f.51.1.1 (A:) GlpG {Escherichia coli [TaxId: 562]}
ragpvtwvmmiacvvvfiamqilgdqevmlwlawpfdptlkfefwryfthalmhfslmhi
lfnllwwwylggavekrlgsgklivitlisallsgyvqqkfsgpwfgglsgvvyalmgyv
wlrgerdpqsgiylqrgliifaliwivagwfdlfgmangahiaglavglamafvdsln

SCOPe Domain Coordinates for d3zota_:

Click to download the PDB-style file with coordinates for d3zota_.
(The format of our PDB-style files is described here.)

Timeline for d3zota_: