SCOPe 2.08: Domain d4k4wa1: 4k4w A:1-461

Lineage for d4k4wa1 (4k4w A:1-461)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
   divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members

4. Superfamily e.8.1: DNA/RNA polymerases [56672] (9 families)
   "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain

5. Family e.8.1.4: RNA-dependent RNA-polymerase [56694] (3 proteins)

6. Protein automated matches [190260] (25 species)
   not a true protein

7. Species Human poliovirus 1 [TaxId:12081] [193135] (16 PDB entries)

8. Domain d4k4wa1: 4k4w A:1-461 [193141]
   Other proteins in same PDB: d4k4wa2, d4k4we2
   automated match to d1ra6a_
   protein/RNA complex

Details for d4k4wa1

PDB Entry: 4k4w, 2.69 Å

PDB Description: Poliovirus polymerase elongation complex (r5+2_form)

PDB Compounds: (A:) RNA-directed RNA polymerase 3D-POL

SCOPe Domain Sequences for d4k4wa1:

Sequence; same for both SEQRES and ATOM records:

>d4k4wa1 e.8.1.4 (A:1-461) automated matches {Human poliovirus 1 [TaxId: 12081]}
geiqwmrpskevgypiinapsktklepsafhyvfegvkepavltkndprlktdfeeaifs
kyvgnkitevdeymkeavdhyagqlmsldinteqmcledamygtdglealdlstsagypy
vamgkkkrdilnkqtrdtkemqklldtyginlplvtyvkdelrsktkveqgksrlieass
lndsvamrmafgnlyaafhknpgvitgsavgcdpdlfwskipvlmeeklfafdytgydas
lspawfealkmvlekigfgdrvdyidylnhshhlyknktycvkggmpsgasgtsifnsmi
nnliirtlllktykgidldhlkmiaygddviasyphevdasllaqsgkdygltmtpadks
atfetvtwenvtflkrffradekypflihpvmpmkeihesirwtkdprntqdhvrslcll
awhngeeeynkflakirsvpigraldlpeystlyrrwldsf

Timeline for d4k4wa1:

• d4k4wa1 first appeared in SCOPe 2.02, called d4k4wa_
  
• d4k4wa1 appears in SCOPe 2.07