Lineage for d1prga_ (1prg A:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 285381Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 285382Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) (S)
  5. 285383Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (25 proteins)
  6. 285487Protein Peroxisome proliferator activated receptor gamma, PPAR-gamma [48524] (1 species)
  7. 285488Species Human (Homo sapiens) [TaxId:9606] [48525] (10 PDB entries)
  8. 285492Domain d1prga_: 1prg A: [19314]

Details for d1prga_

PDB Entry: 1prg (more details), 2.2 Å

PDB Description: ligand binding domain of the human peroxisome proliferator activated receptor gamma

SCOP Domain Sequences for d1prga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1prga_ a.123.1.1 (A:) Peroxisome proliferator activated receptor gamma, PPAR-gamma {Human (Homo sapiens)}
esadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfkh
itplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheii
ytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlai
fiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqiv
tehvqllqvikktetdmslhpllqeiykdl

SCOP Domain Coordinates for d1prga_:

Click to download the PDB-style file with coordinates for d1prga_.
(The format of our PDB-style files is described here.)

Timeline for d1prga_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1prgb_