SCOPe 2.02: Domain d4jv8b_: 4jv8 B:

Lineage for d4jv8b_ (4jv8 B:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.8: RhoGDI-like [81288] (3 proteins)

6. Protein GMP-PDE delta [74846] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [74847] (10 PDB entries)

8. Domain d4jv8b_: 4jv8 B: [193134]
   automated match to d1kshb_
   complexed with 1m1

Details for d4jv8b_

PDB Entry: 4jv8, 1.45 Å

PDB Description: The crystal structure of PDE6D in complex with rac-S1

PDB Compounds: (B:) Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta

SCOPe Domain Sequences for d4jv8b_:

Sequence, based on SEQRES records:

>d4jv8b_ b.1.18.8 (B:) GMP-PDE delta {Human (Homo sapiens) [TaxId: 9606]}
sakderareilrgfklnwmnlrdaetgkilwqgtedlsvpgvehearvpkkilkckavsr
elnfssteqmekfrleqkvyfkgqcleewffefgfvipnstntwqslieaapesqmmpas
vltgnviietkffdddllvstsrvrlfyv

Sequence, based on observed residues (ATOM records):

>d4jv8b_ b.1.18.8 (B:) GMP-PDE delta {Human (Homo sapiens) [TaxId: 9606]}
sakderareilrgfklnwmnlrdaetgkilwqgtedlsvpgvehearvpkkilkckavsr
elnfssteqmekfrleqkvyfkgqcleewffefgfvipnstntwqslieaasqmmpasvl
tgnviietkffdddllvstsrvrlfyv

Timeline for d4jv8b_:

• d4jv8b_ is new in SCOPe 2.02-stable
  
• d4jv8b_ appears in SCOPe 2.03
  
• d4jv8b_ appears in the current release, SCOPe 2.08