Lineage for d1qkub_ (1qku B:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 776482Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 776483Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) (S)
  5. 776484Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (33 proteins)
  6. 776557Protein Estrogen receptor alpha [48519] (1 species)
  7. 776558Species Human (Homo sapiens) [TaxId:9606] [48520] (29 PDB entries)
    Uniprot P03372 307-551
  8. 776606Domain d1qkub_: 1qku B: [19307]
    complex with estradiol

Details for d1qkub_

PDB Entry: 1qku (more details), 3.2 Å

PDB Description: wild type estrogen nuclear receptor ligand binding domain complexed with estradiol
PDB Compounds: (B:) estradiol receptor

SCOP Domain Sequences for d1qkub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qkub_ a.123.1.1 (B:) Estrogen receptor alpha {Human (Homo sapiens) [TaxId: 9606]}
nslalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakr
vpgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmve
ifdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkit
dtlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplydlllem
ldahrlh

SCOP Domain Coordinates for d1qkub_:

Click to download the PDB-style file with coordinates for d1qkub_.
(The format of our PDB-style files is described here.)

Timeline for d1qkub_: