| Class a: All alpha proteins [46456] (285 folds) |
| Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
| Family a.39.1.5: Calmodulin-like [47502] (24 proteins) Duplication: made with two pairs of EF-hands |
| Protein Troponin C [47503] (6 species) |
| Species Human (Homo sapiens), cardiac isoform [TaxId:9606] [47508] (16 PDB entries) |
| Domain d4gjga_: 4gjg A: [193067] automated match to d1r2ua_ complexed with act, ca, cd, gol; mutant |
PDB Entry: 4gjg (more details), 2 Å
SCOPe Domain Sequences for d4gjga_:
Sequence, based on SEQRES records: (download)
>d4gjga_ a.39.1.5 (A:) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]}
mndiykaaveqlteeqknefkaafdifiqdaedgcistkelgkvmrmlgqnptpeelqem
idevdedgsgtvdfdeflvmmvrcmkdds
>d4gjga_ a.39.1.5 (A:) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]}
mndiykaaveqlteeqknefkaafdifiqdaedgcistkelgkvmrmlgqnptpeelqem
idevdegtvdfdeflvmmvrcmkdds
Timeline for d4gjga_: