Lineage for d4bftb_ (4bft B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2479613Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2479614Protein automated matches [190123] (156 species)
    not a true protein
  7. 2480632Species Mycobacterium tuberculosis [TaxId:83332] [187746] (23 PDB entries)
  8. 2480648Domain d4bftb_: 4bft B: [193025]
    automated match to d2gesa_
    complexed with po4, zvt

Details for d4bftb_

PDB Entry: 4bft (more details), 2.29 Å

PDB Description: crystal structure of mycobacterium tuberculosis pank in complex with a triazole inhibitory compound (1b) and phosphate
PDB Compounds: (B:) pantothenate kinase

SCOPe Domain Sequences for d4bftb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bftb_ c.37.1.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
pspyvefdrrqwralrmstplalteeelvglrglgeqidlleveevylplarlihlqvaa
rqrlfaataeflgepqqnpdrpvpfiigvagsvavgksttarvlqallarwdhhprvdlv
ttdgflypnaelqrrnlmhrkgfpesynrralmrfvtsvksgsdyacapvyshlhydiip
gaeqvvrhpdilileglnvlqtgptlmvsdlfdfslyvdariedieqwyvsrflamrtta
fadpeshfhhyaafsdsqavvaareiwrtinrpnlvenilptrpratlvlrkdadhsinr
lrlrkl

SCOPe Domain Coordinates for d4bftb_:

Click to download the PDB-style file with coordinates for d4bftb_.
(The format of our PDB-style files is described here.)

Timeline for d4bftb_: