SCOPe 2.03: Domain d4h49c_: 4h49 C:

Lineage for d4h49c_ (4h49 C:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families)

5. Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)

6. Protein automated matches [190182] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186920] (30 PDB entries)

8. Domain d4h49c_: 4h49 C: [192934]
   automated match to d1os9a_
   complexed with ca, dms, gol, l29, peg, pgo, zn

Details for d4h49c_

PDB Entry: 4h49, 2.16 Å

PDB Description: crystal structure of the catalytic domain of mmp-12 in complex with a twin inhibitor.

PDB Compounds: (C:) Macrophage metalloelastase

SCOPe Domain Sequences for d4h49c_:

Sequence; same for both SEQRES and ATOM records:

>d4h49c_ d.92.1.11 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfarga
hgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighslglg
hssdpkavmfptykyvdintfrlsaddirgiqslyg

Timeline for d4h49c_:

• d4h49c_ first appeared in SCOPe 2.02
  
• d4h49c_ appears in SCOPe 2.04
  
• d4h49c_ appears in the current release, SCOPe 2.08