Lineage for d4il6k_ (4il6 K:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2631976Superfamily f.23.36: Photosystem II reaction center protein K, PsbK [161037] (2 families) (S)
    automatically mapped to Pfam PF02533
  5. 2631977Family f.23.36.1: PsbK-like [161038] (2 proteins)
    Pfam PF02533
  6. 2631978Protein Photosystem II reaction center protein K, PsbK [161039] (2 species)
  7. 2631985Species Thermosynechococcus vulcanus [TaxId:32053] [192450] (25 PDB entries)
  8. 2631997Domain d4il6k_: 4il6 K: [192902]
    Other proteins in same PDB: d4il6a_, d4il6b_, d4il6c_, d4il6d_, d4il6e_, d4il6f_, d4il6h_, d4il6j_, d4il6l_, d4il6m_, d4il6o_, d4il6u_, d4il6v_, d4il6x_, d4il6z_
    automated match to d2axtk1
    complexed with bcr, bct, cl, cla, dgd, dms, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oer, pho, pl9, sqd, unl

Details for d4il6k_

PDB Entry: 4il6 (more details), 2.1 Å

PDB Description: structure of sr-substituted photosystem ii
PDB Compounds: (K:) Photosystem II reaction center protein K

SCOPe Domain Sequences for d4il6k_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4il6k_ f.23.36.1 (K:) Photosystem II reaction center protein K, PsbK {Thermosynechococcus vulcanus [TaxId: 32053]}
klpeayaifdplvdvlpvipvlflalafvwqaavgfr

SCOPe Domain Coordinates for d4il6k_:

Click to download the PDB-style file with coordinates for d4il6k_.
(The format of our PDB-style files is described here.)

Timeline for d4il6k_: