Lineage for d4elfa1 (4elf A:1-162)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2903429Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 2903430Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 2904032Family c.71.1.0: automated matches [191485] (1 protein)
    not a true family
  6. 2904033Protein automated matches [190777] (28 species)
    not a true protein
  7. 2904038Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [188674] (20 PDB entries)
  8. 2904079Domain d4elfa1: 4elf A:1-162 [192887]
    Other proteins in same PDB: d4elfa2, d4elfb2, d4elfc2, d4elfd2, d4elfe2, d4elff2, d4elfg2, d4elfh2
    automated match to d3fl8a_
    complexed with 35i, ca, cl

Details for d4elfa1

PDB Entry: 4elf (more details), 2.3 Å

PDB Description: Structure-activity relationship guides enantiomeric preference among potent inhibitors of B. anthracis dihydrofolate reductase
PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d4elfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4elfa1 c.71.1.0 (A:1-162) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
mivsfmvamdenrvigkdnnlpwrlpselqyvkkttmghplimgrknyeaigrplpgrrn
iivtrnegyhvegcevahsveevfelckneeeififggaqiydlflpyvdklyitkihha
fegdtffpemdmtnwkevfvekgltdeknpytyyyhvyekqq

SCOPe Domain Coordinates for d4elfa1:

Click to download the PDB-style file with coordinates for d4elfa1.
(The format of our PDB-style files is described here.)

Timeline for d4elfa1: