![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest |
![]() | Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) ![]() |
![]() | Family c.71.1.0: automated matches [191485] (1 protein) not a true family |
![]() | Protein automated matches [190777] (28 species) not a true protein |
![]() | Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [188674] (20 PDB entries) |
![]() | Domain d4elfg1: 4elf G:1-162 [192891] Other proteins in same PDB: d4elfa2, d4elfb2, d4elfc2, d4elfd2, d4elfe2, d4elff2, d4elfg2, d4elfh2 automated match to d3fl8a_ complexed with 35i, ca, cl |
PDB Entry: 4elf (more details), 2.3 Å
SCOPe Domain Sequences for d4elfg1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4elfg1 c.71.1.0 (G:1-162) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]} mivsfmvamdenrvigkdnnlpwrlpselqyvkkttmghplimgrknyeaigrplpgrrn iivtrnegyhvegcevahsveevfelckneeeififggaqiydlflpyvdklyitkihha fegdtffpemdmtnwkevfvekgltdeknpytyyyhvyekqq
Timeline for d4elfg1: