Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.1: Acetylcholinesterase-like [53475] (6 proteins) automatically mapped to Pfam PF00135 |
Protein Acetylcholinesterase [53476] (5 species) |
Species Mouse (Mus musculus) [TaxId:10090] [53479] (17 PDB entries) |
Domain d4bc1d_: 4bc1 D: [192857] automated match to d1maac_ complexed with cl, nag, so4, tqv |
PDB Entry: 4bc1 (more details), 2.95 Å
SCOPe Domain Sequences for d4bc1d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4bc1d_ c.69.1.1 (D:) Acetylcholinesterase {Mouse (Mus musculus) [TaxId: 10090]} edpqllvrvrggqlrgirlkapggpvsaflgipfaeppvgsrrfmppepkrpwsgvldat tfqnvcyqyvdtlypgfegtemwnpnrelsedclylnvwtpyprpasptpvliwiygggf ysgaasldvydgrflaqvegavlvsmnyrvgtfgflalpgsreapgnvglldqrlalqwv qeniaafggdpmsvtlfgesagaasvgmhilslpsrslfhravlqsgtpngpwatvsage arrratllarlvgcppggaggndteliaclrtrpaqdlvdhewhvlpqesifrfsfvpvv dgdflsdtpealintgdfqdlqvlvgvvkdegsyflvygvpgfskdneslisraqflagv rigvpqasdlaaeavvlhytdwlhpedpthlrdamsavvgdhnvvcpvaqlagrlaaqga rvyayifehrastltwplwmgvphgyeiefifglpldpslnytteerifaqrlmkywtnf artgdpndprdskspqwppyttaaqqyvslnlkplevrrglraqtcafwnrflpkllsat
Timeline for d4bc1d_: