SCOPe 2.02: Domain d4f7cd_: 4f7c D:

Lineage for d4f7cd_ (4f7c D:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein beta2-microglobulin [88600] (5 species)

7. Species Cow (Bos taurus) [TaxId:9913] [48946] (6 PDB entries)

8. Domain d4f7cd_: 4f7c D: [192831]
   automated match to d2xfxb_
   complexed with 0sg

Details for d4f7cd_

PDB Entry: 4f7c, 2.86 Å

PDB Description: crystal structure of bovine cd1d with bound c12-di-sulfatide

PDB Compounds: (D:) Beta-2-microglobulin

SCOPe Domain Sequences for d4f7cd_:

Sequence; same for both SEQRES and ATOM records:

>d4f7cd_ b.1.1.2 (D:) beta2-microglobulin {Cow (Bos taurus) [TaxId: 9913]}
iqrppkiqvysrhppedgkpnylncyvygfhppqieidllkngekikseqsdlsfskdws
fyllshaeftpnskdqyscrvkhvtleqprivkwdrd

Timeline for d4f7cd_:

• d4f7cd_ is new in SCOPe 2.02-stable
  
• d4f7cd_ appears in SCOPe 2.03
  
• d4f7cd_ appears in the current release, SCOPe 2.08