| Class b: All beta proteins [48724] (174 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein beta2-microglobulin [88600] (5 species) |
| Species Cow (Bos taurus) [TaxId:9913] [48946] (6 PDB entries) |
| Domain d4f7cd_: 4f7c D: [192831] automated match to d2xfxb_ complexed with 0sg |
PDB Entry: 4f7c (more details), 2.86 Å
SCOPe Domain Sequences for d4f7cd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4f7cd_ b.1.1.2 (D:) beta2-microglobulin {Cow (Bos taurus) [TaxId: 9913]}
iqrppkiqvysrhppedgkpnylncyvygfhppqieidllkngekikseqsdlsfskdws
fyllshaeftpnskdqyscrvkhvtleqprivkwdrd
Timeline for d4f7cd_: