Lineage for d1fcza_ (1fcz A:)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 100952Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
  4. 100953Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) (S)
  5. 100954Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (15 proteins)
  6. 101035Protein Retinoic acid receptor gamma (RAR-gamma) [48515] (1 species)
  7. 101036Species Human (Homo sapiens) [TaxId:9606] [48516] (8 PDB entries)
  8. 101038Domain d1fcza_: 1fcz A: [19283]

Details for d1fcza_

PDB Entry: 1fcz (more details), 1.38 Å

PDB Description: isotype selectivity of the human retinoic acid nuclear receptor hrar: the complex with the panagonist retinoid bms181156

SCOP Domain Sequences for d1fcza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fcza_ a.123.1.1 (A:) Retinoic acid receptor gamma (RAR-gamma) {Human (Homo sapiens)}
spqleelitkvskahqetfpslcqlgkyttnssadhrvqldlglwdkfselatkciikiv
efakrlpgftglsiadqitllkaacldilmlrictrytpeqdtmtfsdgltlnrtqmhna
gfgpltdlvfafagqllplemddtetgllsaiclicgdrmdleepekvdklqepllealr
lyarrrrpsqpymfprmlmkitdlrgistkgaeraitlkmeipgpmppliremle

SCOP Domain Coordinates for d1fcza_:

Click to download the PDB-style file with coordinates for d1fcza_.
(The format of our PDB-style files is described here.)

Timeline for d1fcza_: