Lineage for d3q81a_ (3q81 A:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3012718Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 3012719Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 3012720Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
    in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
  6. 3013567Protein automated matches [190161] (29 species)
    not a true protein
  7. 3013942Species Staphylococcus aureus [TaxId:1280] [189852] (11 PDB entries)
  8. 3013947Domain d3q81a_: 3q81 A: [192784]
    automated match to d3q7za_
    complexed with gol, im2

Details for d3q81a_

PDB Entry: 3q81 (more details), 2 Å

PDB Description: Imipenem acylated BlaR1 sensor domain from Staphylococcus aureus
PDB Compounds: (A:) Beta-lactamase regulatory protein BlaR1

SCOPe Domain Sequences for d3q81a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3q81a_ e.3.1.1 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]}
qsitdynykkplhndyqildkskifgsnsgsfvmysmaadayyiynekesrkryspnsty
kiylamfgldrhiindensrmswnhkhypfdawnkeqdlntamqnsvnwyferisdqipk
nytatqlkqlnygnknlgsyksywmedslkisnleqvivfknmmeqnnhfskkaknqlss
sllikknekyelygktgtgivngkynngwfvgyvitnhdkyyfathlsdgkpsgknaeli
sekilkemgvln

SCOPe Domain Coordinates for d3q81a_:

Click to download the PDB-style file with coordinates for d3q81a_.
(The format of our PDB-style files is described here.)

Timeline for d3q81a_: