Lineage for d3r8bh_ (3r8b H:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1103262Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1103263Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1105645Protein automated matches [190119] (15 species)
    not a true protein
  7. 1105877Species Rattus norvegicus [TaxId:10116] [192775] (1 PDB entry)
  8. 1105880Domain d3r8bh_: 3r8b H: [192780]
    automated match to d2apfa_
    complexed with cl, so4, zn

Details for d3r8bh_

PDB Entry: 3r8b (more details), 2.95 Å

PDB Description: Crystal structure of Staphylococcal Enterotoxin B in complex with an affinity matured mouse TCR VBeta8.2 protein, G5-8
PDB Compounds: (H:) g5-8

SCOPe Domain Sequences for d3r8bh_:

Sequence, based on SEQRES records: (download)

>d3r8bh_ b.1.1.1 (H:) automated matches {Rattus norvegicus [TaxId: 10116]}
eaavtqsprnkvavtgekvtlsckqtnsyfnnmywyrqdtghelrlifmshgirnvekgd
ipdgykasrpsqenfslilelatpsqtsvyfcasggggtlyfgagtrlsvlygs

Sequence, based on observed residues (ATOM records): (download)

>d3r8bh_ b.1.1.1 (H:) automated matches {Rattus norvegicus [TaxId: 10116]}
eaavtqsprnkvavtgekvtlsckqtnsyfnnmywyrqdtghelrlifmshgirnvekgd
ipdgykasrpsqenfslilelatpsqtsvyfcasgggtlyfgagtrlsvlygs

SCOPe Domain Coordinates for d3r8bh_:

Click to download the PDB-style file with coordinates for d3r8bh_.
(The format of our PDB-style files is described here.)

Timeline for d3r8bh_: