Lineage for d3ojfa_ (3ojf A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1826923Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 1827463Protein Enoyl-ACP reductase [51791] (11 species)
  7. 1827469Species Bacillus cereus [TaxId:226900] [192761] (2 PDB entries)
  8. 1827470Domain d3ojfa_: 3ojf A: [192762]
    Other proteins in same PDB: d3ojfd_
    automated match to d2qiod_
    complexed with imj, ndp

Details for d3ojfa_

PDB Entry: 3ojf (more details), 2.2 Å

PDB Description: Crystal Structure of the Bacillus cereus Enoyl-Acyl Carrier Protein Reductase with NADP+ and indole naphthyridinone (Complex form)
PDB Compounds: (A:) Enoyl-[acyl-carrier-protein] reductase (FabL) (NADPH)

SCOPe Domain Sequences for d3ojfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ojfa_ c.2.1.2 (A:) Enoyl-ACP reductase {Bacillus cereus [TaxId: 226900]}
mellqgktfvvmgvanqrsiawgiarslhnagakliftyagerlernvreladtlegqes
lvlpcdvtndeeltacfetikqevgtihgvahciafanrddlkgefvdtsrdgfllaqni
safsltavareakkvmteggniltltylggervvknynvmgvakasleasvkylandlgq
hgirvnaisagpirtlsakgvgdfnsilreieeraplrrtttqeevgdtavflfsdlarg
vtgenihvdsgyhilgl

SCOPe Domain Coordinates for d3ojfa_:

Click to download the PDB-style file with coordinates for d3ojfa_.
(The format of our PDB-style files is described here.)

Timeline for d3ojfa_: