SCOPe 2.02: Domain d3ojfa_: 3ojf A:

Lineage for d3ojfa_ (3ojf A:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
   also known as short-chain dehydrogenases and SDR family
   parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

6. Protein Enoyl-ACP reductase [51791] (11 species)

7. Species Bacillus cereus [TaxId:226900] [192761] (1 PDB entry)

8. Domain d3ojfa_: 3ojf A: [192762]
   Other proteins in same PDB: d3ojfd_
   automated match to d2qiod_
   complexed with imj, ndp

Details for d3ojfa_

PDB Entry: 3ojf, 2.2 Å

PDB Description: Crystal Structure of the Bacillus cereus Enoyl-Acyl Carrier Protein Reductase with NADP+ and indole naphthyridinone (Complex form)

PDB Compounds: (A:) Enoyl-[acyl-carrier-protein] reductase (FabL) (NADPH)

SCOPe Domain Sequences for d3ojfa_:

Sequence; same for both SEQRES and ATOM records:

>d3ojfa_ c.2.1.2 (A:) Enoyl-ACP reductase {Bacillus cereus [TaxId: 226900]}
mellqgktfvvmgvanqrsiawgiarslhnagakliftyagerlernvreladtlegqes
lvlpcdvtndeeltacfetikqevgtihgvahciafanrddlkgefvdtsrdgfllaqni
safsltavareakkvmteggniltltylggervvknynvmgvakasleasvkylandlgq
hgirvnaisagpirtlsakgvgdfnsilreieeraplrrtttqeevgdtavflfsdlarg
vtgenihvdsgyhilgl

Timeline for d3ojfa_:

• d3ojfa_ is new in SCOPe 2.02-stable
  
• d3ojfa_ appears in SCOPe 2.03
  
• d3ojfa_ appears in the current release, SCOPe 2.08, called d3ojfa1