SCOPe 2.06: Domain d3gj0b_: 3gj0 B:

Lineage for d3gj0b_ (3gj0 B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186768] (179 PDB entries)

8. Domain d3gj0b_: 3gj0 B: [192728]
   Other proteins in same PDB: d3gj0a2
   automated match to d1rrpa_
   complexed with gdp, mg

Details for d3gj0b_

PDB Entry: 3gj0, 1.48 Å

PDB Description: Crystal structure of human RanGDP

PDB Compounds: (B:) GTP-binding nuclear protein ran

SCOPe Domain Sequences for d3gj0b_:

Sequence, based on SEQRES records:

>d3gj0b_ c.37.1.8 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwdta
gqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdik
drkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampalappev
vmdpalaaqyehdlevaqt

Sequence, based on observed residues (ATOM records):

>d3gj0b_ c.37.1.8 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwdta
glrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdikdrkvka
ksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampalappevvmdpal
aaqyehdlevaqt

Timeline for d3gj0b_:

• d3gj0b_ first appeared in SCOPe 2.02
  
• d3gj0b_ appears in SCOPe 2.05
  
• d3gj0b_ appears in SCOPe 2.07
  
• d3gj0b_ appears in the current release, SCOPe 2.08