Lineage for d3dwtc_ (3dwt C:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2021376Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2023921Protein automated matches [190119] (22 species)
    not a true protein
  7. 2023922Species Camel (Camelus dromedarius) [TaxId:9838] [187219] (33 PDB entries)
  8. 2023977Domain d3dwtc_: 3dwt C: [192721]
    automated match to d1bzqk_
    complexed with gol

Details for d3dwtc_

PDB Entry: 3dwt (more details), 2.9 Å

PDB Description: Structure of CabBCII-10 nanobody
PDB Compounds: (C:) cAbBCII-10

SCOPe Domain Sequences for d3dwtc_:

Sequence, based on SEQRES records: (download)

>d3dwtc_ b.1.1.1 (C:) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
vqlvesgggsvqaggslrlsctasggseysystfslgwfrqapgqereavaaiasmgglt
yyadsvkgrftisrdnakntvtlqmnnlkpedtaiyycaavrgyfmrlpsshnfrywgqg
tqvtvssr

Sequence, based on observed residues (ATOM records): (download)

>d3dwtc_ b.1.1.1 (C:) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
vqlvesgggsvqaggslrlsctasggssystfslgwfrqapgqereavaaiasmggltyy
adsvkgrftisrdnakntvtlqmnnlkpedtaiyycaavrgyfmrlpsshnfrywgqgtq
vtvssr

SCOPe Domain Coordinates for d3dwtc_:

Click to download the PDB-style file with coordinates for d3dwtc_.
(The format of our PDB-style files is described here.)

Timeline for d3dwtc_: