![]() | Class a: All alpha proteins [46456] (171 folds) |
![]() | Fold a.157: Skp1 dimerisation domain-like [81384] (1 superfamily) multihelical; interlocked heterodimer with F-box proteins |
![]() | Superfamily a.157.1: Skp1 dimerisation domain-like [81382] (1 family) ![]() |
![]() | Family a.157.1.1: Skp1 dimerisation domain-like [81380] (2 proteins) |
![]() | Protein Cyclin A/CDK2-associated p45, Skp1 [81378] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [81376] (4 PDB entries) |
![]() | Domain d1fs2b1: 1fs2 B:80-146 [19272] Other proteins in same PDB: d1fs2a1, d1fs2a2, d1fs2b2, d1fs2c1, d1fs2c2, d1fs2d2 |
PDB Entry: 1fs2 (more details), 2.9 Å
SCOP Domain Sequences for d1fs2b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fs2b1 a.157.1.1 (B:80-146) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens)} krtddipvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmikgktpeeirktf nikndft
Timeline for d1fs2b1: