Lineage for d4fb1e_ (4fb1 E:)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1704092Fold g.21: Methylamine dehydrogenase, L chain [57560] (1 superfamily)
    disulfide-rich; nearly all-beta
  4. 1704093Superfamily g.21.1: Methylamine dehydrogenase, L chain [57561] (2 families) (S)
  5. 1704094Family g.21.1.1: Methylamine dehydrogenase, L chain [57562] (2 proteins)
    automatically mapped to Pfam PF02975
  6. 1704115Protein automated matches [190303] (3 species)
    not a true protein
  7. 1704116Species Paracoccus denitrificans [TaxId:266] [187112] (13 PDB entries)
  8. 1704138Domain d4fb1e_: 4fb1 E: [192672]
    automated match to d2bbkl_
    complexed with ca, hec, mes, na

Details for d4fb1e_

PDB Entry: 4fb1 (more details), 2.15 Å

PDB Description: Crystal Structure of WT MauG in Complex with Pre-Methylamine Dehydrogenase Aged 60 Days
PDB Compounds: (E:) Methylamine dehydrogenase light chain

SCOPe Domain Sequences for d4fb1e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fb1e_ g.21.1.1 (E:) automated matches {Paracoccus denitrificans [TaxId: 266]}
tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
vgkas

SCOPe Domain Coordinates for d4fb1e_:

Click to download the PDB-style file with coordinates for d4fb1e_.
(The format of our PDB-style files is described here.)

Timeline for d4fb1e_: