SCOPe 2.06: Domain d4dpea_: 4dpe A:

Lineage for d4dpea_ (4dpe A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families)

5. Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)

6. Protein Stromelysin-1 (MMP-3) [55536] (1 species)

7. Species Human (Homo sapiens), fibroblast [TaxId:9606] [55537] (40 PDB entries)

8. Domain d4dpea_: 4dpe A: [192636]
   automated match to d1hy7b_
   complexed with ca, cl, ngh, pt, zn

Details for d4dpea_

PDB Entry: 4dpe, 1.96 Å

PDB Description: Structure of MMP3 complexed with a platinum-based inhibitor.

PDB Compounds: (A:) stromelysin-1

SCOPe Domain Sequences for d4dpea_:

Sequence; same for both SEQRES and ATOM records:

>d4dpea_ d.92.1.11 (A:) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast [TaxId: 9606]}
frtfpgipkwrkthltyrivnytpdlpkdavdsavekalkvweevtpltfsrlyegeadi
misfavrehgdfypfdgpgnvlahayapgpgingdahfdddeqwtkdttgtnlflvaahe
ighslglfhsantealmyplyhsltdltrfrlsqddingiqslygppp

Timeline for d4dpea_:

• d4dpea_ first appeared in SCOPe 2.02
  
• d4dpea_ appears in SCOPe 2.05
  
• d4dpea_ appears in SCOPe 2.07
  
• d4dpea_ appears in the current release, SCOPe 2.08