SCOPe 2.06: Domain d4hbhl_: 4hbh L:

Lineage for d4hbhl_ (4hbh L:)

1. Root: SCOPe 2.06

2. Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)
   automatically mapped to Pfam PF00124

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
   L and M are probably related to each other

6. Protein L (light) subunit [81477] (3 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [81475] (62 PDB entries)
   Uniprot P02954

8. Domain d4hbhl_: 4hbh L: [192604]
   Other proteins in same PDB: d4hbhh1, d4hbhh2, d4hbhm_
   automated match to d1qovl_
   complexed with bcl, bph, fe, spo, u10

Details for d4hbhl_

PDB Entry: 4hbh, 2.93 Å

PDB Description: bacterial photosynthetic reaction center from rhodobacter sphaeroides with ile m265 replaced with asn

PDB Compounds: (L:) reaction center protein l chain

SCOPe Domain Sequences for d4hbhl_:

Sequence; same for both SEQRES and ATOM records:

>d4hbhl_ f.26.1.1 (L:) L (light) subunit {Rhodobacter sphaeroides [TaxId: 1063]}
allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn
pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa
fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff
ftnalalalhgalvlsaanpekgkemrtpdhedtffrdlvgysigtlgihrlglllslsa
vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging

Timeline for d4hbhl_:

• d4hbhl_ first appeared in SCOPe 2.02
  
• d4hbhl_ appears in SCOPe 2.05
  
• d4hbhl_ appears in SCOPe 2.07
  
• d4hbhl_ appears in the current release, SCOPe 2.08