SCOPe 2.06: Domain d3v2va_: 3v2v A:

Lineage for d3v2va_ (3v2v A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Myoglobin [46469] (10 species)

7. Species Horse (Equus caballus) [TaxId:9796] [46474] (84 PDB entries)

8. Domain d3v2va_: 3v2v A: [192558]
   automated match to d2v1fa_
   complexed with hkl, na, no2, so4

Details for d3v2va_

PDB Entry: 3v2v, 1.65 Å

PDB Description: Nitrite Bound Chlorin Substituted Myoglobin- Method 1

PDB Compounds: (A:) Myoglobin

SCOPe Domain Sequences for d3v2va_:

Sequence; same for both SEQRES and ATOM records:

>d3v2va_ a.1.1.2 (A:) Myoglobin {Horse (Equus caballus) [TaxId: 9796]}
glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased
lkkhgtvvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskhp
gdfgadaqgamtkalelfrndiaakykelgfq

Timeline for d3v2va_:

• d3v2va_ first appeared in SCOPe 2.02
  
• d3v2va_ appears in SCOPe 2.05
  
• d3v2va_ appears in SCOPe 2.07
  
• d3v2va_ appears in the current release, SCOPe 2.08