Lineage for d3tb0a_ (3tb0 A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1779936Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1779937Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1781626Family b.29.1.14: vp4 sialic acid binding domain [74907] (2 proteins)
    automatically mapped to Pfam PF00426
  6. 1781627Protein vp4 sialic acid binding domain [74908] (1 species)
  7. 1781628Species Rhesus rotavirus [TaxId:10969] [74909] (6 PDB entries)
  8. 1781633Domain d3tb0a_: 3tb0 A: [192513]
    automated match to d2p3ka_
    complexed with 1pe, gol, mn0

Details for d3tb0a_

PDB Entry: 3tb0 (more details), 2 Å

PDB Description: crystal structure of rhesus rotavirus vp8* in complex with n- glycolylneuraminic acid
PDB Compounds: (A:) Outer capsid protein VP4

SCOPe Domain Sequences for d3tb0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tb0a_ b.29.1.14 (A:) vp4 sialic acid binding domain {Rhesus rotavirus [TaxId: 10969]}
vldgpyqpttfnppvdywmllaptaagvvvegtnntdrwlatilvepnvtsetrsytlfg
tqeqitianasqtqwkfidvvkttqngsysqygplqstpklyavmkhngkiytyngetpn
vttkyysttnydsvnmtafcdfyiipreeestcteyinngl

SCOPe Domain Coordinates for d3tb0a_:

Click to download the PDB-style file with coordinates for d3tb0a_.
(The format of our PDB-style files is described here.)

Timeline for d3tb0a_: