Class b: All beta proteins [48724] (176 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) |
Family b.29.1.14: vp4 sialic acid binding domain [74907] (2 proteins) automatically mapped to Pfam PF00426 |
Protein vp4 sialic acid binding domain [74908] (1 species) |
Species Rhesus rotavirus [TaxId:10969] [74909] (6 PDB entries) |
Domain d3tb0a_: 3tb0 A: [192513] automated match to d2p3ka_ complexed with 1pe, gol, mn0 |
PDB Entry: 3tb0 (more details), 2 Å
SCOPe Domain Sequences for d3tb0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tb0a_ b.29.1.14 (A:) vp4 sialic acid binding domain {Rhesus rotavirus [TaxId: 10969]} vldgpyqpttfnppvdywmllaptaagvvvegtnntdrwlatilvepnvtsetrsytlfg tqeqitianasqtqwkfidvvkttqngsysqygplqstpklyavmkhngkiytyngetpn vttkyysttnydsvnmtafcdfyiipreeestcteyinngl
Timeline for d3tb0a_: